PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676715390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family Dof
Protein Properties Length: 539aa    MW: 61004.4 Da    PI: 6.9647
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676715390genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.7e-3757116261
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                ++k+l+cprC+s++tkfCyynny+++qPr+fC++C+ryWt GG++r vPvG+grrknk +
  676715390  57 PDKILPCPRCNSADTKFCYYNNYNVNQPRHFCRNCQRYWTSGGSMRTVPVGSGRRKNKGW 116
                7899*****************************************************976 PP

2zf-Dof1183.7e-37273332261
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                ++k+l+cprC+s++tkfCyynny+++qPr+fC++C+ryWt GG++r vPvG+grrknk +
  676715390 273 PDKILPCPRCNSADTKFCYYNNYNVNQPRHFCRNCQRYWTSGGSMRTVPVGSGRRKNKGW 332
                7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3153114IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3059114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.32361115IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106399IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-31269330IPR003851Zinc finger, Dof-type
PfamPF027011.6E-30275330IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.323277331IPR003851Zinc finger, Dof-type
PROSITE patternPS013610279315IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MNNQSATDNR EHEDTSLQMS PDLNKESKET SENSDDQHSE ITTTTTSEEK TTDLKKPDKI  60
LPCPRCNSAD TKFCYYNNYN VNQPRHFCRN CQRYWTSGGS MRTVPVGSGR RKNKGWVSTD  120
HYMHVNSETT NIYNSSSAKI LSFESSDSLV ADNRNHQSTN AKITADXSSF FYTPIKLFGW  180
TIASSLSPLL SDSLDLDMEN SSSSSSSSSP SLRPNMMNNQ SATDNREHED TSLQMSPDLN  240
KESKETSENS DDQHSEITTT TTSEEKTTDL KKPDKILPCP RCNSADTKFC YYNNYNVNQP  300
RHFCRNCQRY WTSGGSMRTV PVGSGRRKNK GWVSTDHYMH VNSETTNIYN SSSAKILSFE  360
SSDSLVADNR NHQSTNAKIT ADSASEDSNN FQRFLPPQVT SPVSPPWPYQ YPPNPTFYHI  420
PVYWGCTVPF WSTLETSTCL GKRTRDEASH ESIGQSKDTF VRARLDSQCQ STNNEASVAT  480
KNHVWHPVSM KREKTDNFSF FINGSETQSS NNKYVPQRYL NPHANPAAMA RSMNFRESM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415958.10.0hypothetical protein EUTSA_v10007936mg
SwissprotQ9LQX40.0DOF13_ARATH; Dof zinc finger protein DOF1.3
TrEMBLV4MRD70.0V4MRD7_EUTSA; Uncharacterized protein
STRINGAT1G26790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140821624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26790.11e-152Dof family protein